Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O6:K15:H31 UPF0114 protein YqhA(yqhA)

Recombinant Escherichia coli O6:K15:H31 UPF0114 protein YqhA(yqhA)

SKU:CSB-CF608389EGY

Regular price £1,261.00 GBP
Regular price Sale price £1,261.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O6:K15:H31 (strain 536 / UPEC)

Uniprot NO.:Q0TDA9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH

Protein Names:Recommended name: UPF0114 protein YqhA

Gene Names:Name:yqhA Ordered Locus Names:ECP_3087

Expression Region:1-164

Sequence Info:full length protein

View full details