Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O17:K52:H18 Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Recombinant Escherichia coli O17:K52:H18 Sulfoxide reductase heme-binding subunit YedZ(yedZ)

SKU:CSB-CF483702EOG

Regular price £1,282.00 GBP
Regular price Sale price £1,282.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

Uniprot NO.:B7NBW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLTAKQVTWLKVCLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVVILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLLSLFNRLRKQVHNKLSL

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:ECUMN_2263

Expression Region:1-211

Sequence Info:full length protein

View full details