Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O17:K52:H18 Glycerol-3-phosphate acyltransferase(plsY)

Recombinant Escherichia coli O17:K52:H18 Glycerol-3-phosphate acyltransferase(plsY)

SKU:CSB-CF486295EOG

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

Uniprot NO.:B7ND48

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): G3P acyltransferase Short name= GPAT EC= 2.3.1.15 EC= 2.3.1.n5 Lysophosphatidic acid synthase Short name= LPA synthase

Gene Names:Name:plsY Synonyms:ygiH Ordered Locus Names:ECUMN_3542

Expression Region:1-205

Sequence Info:full length protein

View full details