Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)

Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)

SKU:CSB-EP303998ENV

Regular price £451.00 GBP
Regular price Sale price £451.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Others

Uniprot NO.:P69506

Uniprot Entry Name:

Gene Names:YTFE

Species:Escherichia coli (strain K12)

Source:E.coli

Expression Region:1-220aa

Sequence:MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE

Protein Description:Full Length

Tag Info:N-terminal GST-tagged

Mol. Weight:51.9 kD

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 ?g/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 ?g/ml.

Purity:Greater than 85% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Regulator of cell morphogenesis and NO signaling

Relevance:Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details