Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein yohD(yohD)

Recombinant Escherichia coli Inner membrane protein yohD(yohD)

SKU:CSB-CF327223ENV

Regular price £1,260.00 GBP
Regular price Sale price £1,260.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P33366

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLNTLISQYGYAALVIGSLAEGETVTLLGGVAAHQGLLKFPLVVLSVALGGMIGDQVLY LCGRRFGGKLLRRFSKHQDKIERAQKLIQRHPYLFVIGTRFMYGFRVIGPTLIGASQLPP KIFLPLNILGAFAWALIFTTIGYAGGQVIAPWLHNLDQHLKHWVWLILVVVLVVGVRWWL KRRGKKKPDHQA

Protein Names:Recommended name: Inner membrane protein yohD

Gene Names:Name:yohD Ordered Locus Names:b2136, JW2124

Expression Region:1-192

Sequence Info:full length protein

View full details