Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Fumarate reductase subunit C(frdC)

Recombinant Escherichia coli Fumarate reductase subunit C(frdC)

SKU:CSB-CF469395ENW

Regular price £1,098.00 GBP
Regular price Sale price £1,098.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain SE11)

Uniprot NO.:B6I261

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW

Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein

Gene Names:Name:frdC Ordered Locus Names:ECSE_4454

Expression Region:1-131

Sequence Info:full length protein

View full details