Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Bactoprenol-linked glucose translocase homolog from prophage CPS-53(yfdG)

Recombinant Escherichia coli Bactoprenol-linked glucose translocase homolog from prophage CPS-53(yfdG)

SKU:CSB-CF305211ENV

Regular price £1,203.00 GBP
Regular price Sale price £1,203.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P77682

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLFAKYTSIGVLNTLIHWVVFGVCIYVAHTNQALANFAGFVVAVSFSFFANAKFTFKA STTTMRYMLYVGFMGTLSATVGWAADRCALPPMITLVTFSAISLVCGFVYSKFIVFRDAK

Protein Names:Recommended name: Bactoprenol-linked glucose translocase homolog from prophage CPS-53

Gene Names:Name:yfdG Ordered Locus Names:b2350, JW2346

Expression Region:1-120

Sequence Info:full length protein

View full details