Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Arsenical resistance operon repressor(arsR)

Recombinant Escherichia coli Arsenical resistance operon repressor(arsR)

SKU:CSB-EP327658ENVa0

Regular price £857.00 GBP
Regular price Sale price £857.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P37309

Gene Names:arsR

Organism:Escherichia coli (strain K12)

AA Sequence:MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS

Expression Region:1-117aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:19.0 kDa

Alternative Name(s):arsE

Relevance:Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V))

Reference:"An Escherichia coli chromosomal ars operon homolog is functional in arsenic detoxification and is conserved in Gram-negative bacteria." Diorio C., Cai J., Marmor J., Shinder R., Dubow M.S. J. Bacteriol. 177:2050-2056(1995)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)) (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ecj:JW3468

STRING Database Link:https://string-db.org/network/316385.ECDH10B_3677

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details