Recombinant Escherichia coli Acyl carrier protein(acpP)

Recombinant Escherichia coli Acyl carrier protein(acpP)

CSB-EP015636ENV
Regular price
£637.00 GBP
Sale price
£637.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: acpP

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P0A6A8 

AA Sequence: MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-78aa

Protein length: Full Length

MW: 24.6 kDa

Alternative Name(s): Cytosolic-activating factor

Relevance: Carrier of the growing fatty acid chain in fatty acid biosynthesis.

Reference: "Altered molecular form of acyl carrier protein associated with beta-ketoacyl-acyl carrier protein synthase II (fabF) mutants." Jackowski S., Rock C.O. J. Bacteriol. 169:1469-1473(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share