Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Acidic protein msyB(msyB)

Recombinant Escherichia coli Acidic protein msyB(msyB)

SKU:CSB-BP340725ENV

Regular price £438.00 GBP
Regular price Sale price £438.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P25738

Gene Names: msyB

Organism: Escherichia coli (strain K12)

AA Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER

Expression Region: 1-124aa

Sequence Info: Full Length

Source: Baculovirus

Tag Info: C-terminal 6xHis-tagged

MW: 16.3 kDa

Alternative Name(s):

Relevance: Could participate in the normal pathway of protein export.

Reference: "Multicopy suppression: an approach to understanding intracellular functioning of the protein export system." Ueguchi C., Ito K. J. Bacteriol. 174:1454-1461(1992)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details