Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli 30S ribosomal protein S13(rpsM)

Recombinant Escherichia coli 30S ribosomal protein S13(rpsM)

SKU:CSB-RP087344Ba

Regular price £893.00 GBP
Regular price Sale price £893.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0A7S9

Gene Names: rpsM

Organism: Escherichia coli (strain K12)

AA Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK

Expression Region: 2-118aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40 kDa

Alternative Name(s):

Relevance: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.

Reference: Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level.Pohl T., Wittmann-Liebold B.J. Biol. Chem. 263:4293-4301(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details