Skip to product information
1 of 1

Gene Bio Systems

Recombinant Erwinia amylovora Glucitol-sorbitol permease IIC component(srlA)

Recombinant Erwinia amylovora Glucitol-sorbitol permease IIC component(srlA)

SKU:CSB-CF521866EMS

Regular price £1,252.00 GBP
Regular price Sale price £1,252.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Erwinia amylovora (Fire blight bacteria)

Uniprot NO.:O32521

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIEAITHGAEWFIGLFQKGGEVFVGMVTGILPLLISLLVIMNALIVFVGQRRIEKLAQKC AGNPVTRYLVLPFIGTFVFCNPMTHSLGKFLPEKYKPSYYAAASYSCHSMNGLFPHINPG ELFVYLGIANGLTTLGVPLGPLAVSYLLVGLITNFFRGWVTDLTTSVFEKKMGIKLDKSV HL

Protein Names:Recommended name: Glucitol/sorbitol permease IIC component Alternative name(s): EIIC-Gut PTS system glucitol/sorbitol-specific EIIC component

Gene Names:Name:srlA

Expression Region:1-182

Sequence Info:full length protein

View full details