Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine herpesvirus 1 Envelope protein US9 homolog (76)

Recombinant Equine herpesvirus 1 Envelope protein US9 homolog (76)

SKU:CSB-CF330174EFM

Regular price £1,312.00 GBP
Regular price Sale price £1,312.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine herpesvirus 1 (strain Kentucky A) (EHV-1) (Equine abortion virus)

Uniprot NO.:P32513

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKAEAAAVVIPLSVSNPSYRGSGMSDQEVSEEQSAGDAWVSAAMAAAEAVAAAATSTGI DNTNDYTYTAASENGDPGFTLGDNTYGPNGAASGCPSPPSPEVVGLEMVVVSSLAPEIAA AVPADTISASAAAPATRVDDGNAPLLGPGQAQDYDSESGCYYSESDNETASMFIRRVGRR QARRHRRRRVALTVAGVILVVVLCAISGIVGAFLARVFP

Protein Names:Recommended name: Envelope protein US9 homolog Alternative name(s): Envelope protein 76 ORF76 protein

Gene Names:Ordered Locus Names:76

Expression Region:1-219

Sequence Info:full length protein

View full details