Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine arteritis virus Glycoprotein 4(GP4)

Recombinant Equine arteritis virus Glycoprotein 4(GP4)

SKU:CSB-CF338979EFH

Regular price £1,206.00 GBP
Regular price Sale price £1,206.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine arteritis virus (strain Bucyrus) (EAV)

Uniprot NO.:P28994

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TFYPCHAAEARNFTYISHGLGHVHGHEGCRNFINVTHSAFLYLNPTTPTAPAITHCLLLV LAAKMEHPNATIWLQLQPFGYHVAGDVIVNLEEDKRHPYFKLLRAPALPLGFVAIVYVLL RLVRWAQRCYL

Protein Names:Recommended name: Glycoprotein 4 Short name= Protein GP4

Gene Names:Name:GP4 ORF Names:4

Expression Region:22-152

Sequence Info:full length protein

View full details