Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine arteritis virus Envelope small membrane protein(GP2a)

Recombinant Equine arteritis virus Envelope small membrane protein(GP2a)

SKU:CSB-CF835532EFH

Regular price £1,177.00 GBP
Regular price Sale price £1,177.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine arteritis virus (strain Bucyrus) (EAV)

Uniprot NO.:Q91DM1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GLVWSLISNSIQTIIADFAISVIDAALFFLMLLALAVVTVFLFWLIVAIGRSLVARCSRG ARYRPV

Protein Names:Recommended name: Envelope small membrane protein Short name= Protein E Alternative name(s): Glycoprotein 2a Short name= Protein GP2a

Gene Names:Name:GP2a ORF Names:2a

Expression Region:2-67

Sequence Info:full length protein

View full details