Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

SKU:CSB-CF313736EEZ

Regular price £1,046.00 GBP
Regular price Sale price £1,046.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Uniprot NO.:P0C737

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Protein Names:Recommended name: Protein BNLF2a

Gene Names:ORF Names:BNLF2a

Expression Region:1-60

Sequence Info:full length protein

View full details