Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2)

Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2)

SKU:CSB-CF360991EFA

Regular price £1,293.00 GBP
Regular price Sale price £1,293.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Uniprot NO.:P03218

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FFSDLVKFENVTAHAGARVNLTCSVPSNESVSRIELGRGYTPGDGQLPLAVATSNNGTHI TNGGYNYSLTLEWVNDSNTSVSLIIPNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEE DDQYHANRTLTQRMHLTVIPATTIAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFP IDPWRPKTTWVHWALLLITCAVVAPVLLIIIISCLGWLAGWGRRRKGWIPL

Protein Names:Recommended name: Probable membrane glycoprotein

Gene Names:ORF Names:BILF2

Expression Region:18-248

Sequence Info:full length protein

View full details