Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1)

Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1)

SKU:CSB-CF355987EFA

Regular price £1,236.00 GBP
Regular price Sale price £1,236.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Uniprot NO.:P03230

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNG PHDPLPHSPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHGGGDPHLPT LLLGSSGSGGDDDDPHGPVQLSYYD

Protein Names:Recommended name: Latent membrane protein 1 Short name= LMP-1 Alternative name(s): Protein p63 Cleaved into the following chain: 1. Protein p25

Gene Names:Name:LMP1 ORF Names:BNLF1

Expression Region:242-386

Sequence Info:full length protein

View full details