Gene Bio Systems
Recombinant Enterococcus faecalis UPF0756 membrane protein EF_1246(EF_1246)
Recombinant Enterococcus faecalis UPF0756 membrane protein EF_1246(EF_1246)
SKU:CSB-CF772586ELW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterococcus faecalis (strain ATCC 700802 / V583)
Uniprot NO.:Q835X3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESWLFLLLIALIAFVAKNQSLLIASVVVLALKALPNSAKIMSWLSDKGINLGVTIISIT ILVPIATGQIGLKDLIQSFKTPMGWLGILCGILVAVLSSKGVGLINQSPEITVALVFGTI LGVVFLKGIAAGPIIASGMMYVIITTFQAFQH
Protein Names:Recommended name: UPF0756 membrane protein EF_1246
Gene Names:Ordered Locus Names:EF_1246
Expression Region:1-152
Sequence Info:full length protein
