Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterococcus faecalis UPF0756 membrane protein EF_1246(EF_1246)

Recombinant Enterococcus faecalis UPF0756 membrane protein EF_1246(EF_1246)

SKU:CSB-CF772586ELW

Regular price £1,224.00 GBP
Regular price Sale price £1,224.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterococcus faecalis (strain ATCC 700802 / V583)

Uniprot NO.:Q835X3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESWLFLLLIALIAFVAKNQSLLIASVVVLALKALPNSAKIMSWLSDKGINLGVTIISIT ILVPIATGQIGLKDLIQSFKTPMGWLGILCGILVAVLSSKGVGLINQSPEITVALVFGTI LGVVFLKGIAAGPIIASGMMYVIITTFQAFQH

Protein Names:Recommended name: UPF0756 membrane protein EF_1246

Gene Names:Ordered Locus Names:EF_1246

Expression Region:1-152

Sequence Info:full length protein

View full details