Skip to product information
1 of 1

GeneBio Systems

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

SKU:P03695

Regular price £904.00 GBP
Regular price Sale price £904.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: others

Uniprot ID: P03695

Gene Names: 32

Alternative Name(s): Gp32;Helix-destabilizing protein

Abbreviation: Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

Organism: Enterobacteria phage T4 (Bacteriophage T4)

Source: E.coli

Expression Region: 1-301aa

Protein Length: Full Length

Tag Info: Tag-Free

Target Protein Sequence: MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

MW: 33.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Binds preferentially to single-stranded DNA and therefore, destabilizes double-stranded DNA. It is involved in DNA replication, repair and recombination. Binds ss-DNA as the replication fork advances and stimulates the replisome processivity and accuracy.

Reference: "Crystal structure of a replication fork single-stranded DNA binding protein (T4 gp32) complexed to DNA." Shamoo Y., Friedman A.M., Parsons M.R., Konigsberg W.H., Steitz T.A. Nature 376: 362-366(1995)

Function:

View full details