Gene Bio Systems
Recombinant Enterobacteria phage P2 Holin(Y)
Recombinant Enterobacteria phage P2 Holin(Y)
SKU:CSB-CF345953EDE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacteria phage P2 (Bacteriophage P2)
Uniprot NO.:P51773
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAEEKSVLSLFMIGVLIVVGKVLAGGEPITPRLFIGRMLLGGFVSMVAGVVLVQFPDLS LPAVCGIGSMLGIAGYQVIEIAIQRRFKGRGKQ
Protein Names:Recommended name: Holin
Gene Names:Name:Y
Expression Region:1-93
Sequence Info:full length protein
