Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)

SKU:CSB-EP357663ECC

Regular price £893.00 GBP
Regular price Sale price £893.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P09386

Gene Names: stxB2

Organism: Enterobacteria phage 933W (Bacteriophage 933W)

AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Expression Region: 20-89aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 23.8 kDa

Alternative Name(s): Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Reference: Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.Fraser M.E., Cherney M.M., Marcato P., Mulvey G.L., Armstrong G.D., James M.N.Acta Crystallogr. F 62:627-630(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details