Gene Bio Systems
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)
SKU:CSB-EP357663ECC
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: stxB2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Enterobacteria phage 933W (Bacteriophage 933W)
Delivery time: 3-7 business days
Uniprot ID: P09386
AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-89aa
Protein length: Full Length of Mature Protein
MW: 23.8 kDa
Alternative Name(s): Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B
Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Reference: Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.Fraser M.E., Cherney M.M., Marcato P., Mulvey G.L., Armstrong G.D., James M.N.Acta Crystallogr. F 62:627-630(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
