
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P16239
Gene Names:iceE
Organism:Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans)
AA Sequence:MAGERGKLIAGADSTQTAGDRSKLLAGNNSYLTAGDRSKLTAGNDCILMAGDRSKLTAGINSILTAGCRSKLIGSNGSTLTAGENSVLIFRCWDGKRYTNVVAKTGKGGIEADMPYQMDEDNNIVNKPEE
Expression Region:1129-1258aa
Sequence Info:Partial
Source:Yeast
Tag Info:N-terminal 6xHis-tagged
MW:15.7 kDa
Alternative Name(s):Ice nucleation protein
Relevance:Ice nucleation proteins enable bacteria to nucleate crystallization in supercooled water.
Reference:"Isolation and characterization of hydroxylamine-induced mutations in the Erwinia herbicola ice nucleation gene that selectively reduce warm temperature ice nucleation activity." Gurian-Sherman D., Lindow S.E., Panopoulos N.J. Mol. Microbiol. 9:383-391(1993)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
You may also like
-
Recombinant Xanthomonas campestris pv. translucens Ice nucleation protein(inaX),partial
- Regular price
- £628.00 GBP
- Sale price
- £628.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein(32)
- Regular price
- £628.00 GBP
- Sale price
- £628.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Endo-beta-N-acetylglucosaminidase H,partial
- Regular price
- £400.00 GBP
- Sale price
- £400.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme(ideS)
- Regular price
- £628.00 GBP
- Sale price
- £628.00 GBP
- Regular price
-
- Unit price
- per
Sold out