Skip to product information
1 of 1

Gene Bio Systems

Recombinant Elephas maximus NADH-ubiquinone oxidoreductase chain 6(MT-ND6)

Recombinant Elephas maximus NADH-ubiquinone oxidoreductase chain 6(MT-ND6)

SKU:CSB-CF643178EKA-GB

Regular price £1,263.00 GBP
Regular price Sale price £1,263.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Elephas maximus (Indian elephant)

Uniprot NO.:Q2I3G3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMYIVFIMSVLYVVGFIGFSSKPSPVYGGMSLVVSGGLGCGIIMSSGGSFLGLVVFLVYL GGMMVVFGYTIAMATEEYPETWGSNVVVLSAFLVGLLMEVFMVVWLFSGEHELVGFYFGG LESFVTLGEGGFEYVREDYSGGASLYSCGFWFLAMAGWMLFVSIFIATEITRKRY

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6

Gene Names:Name:MT-ND6 Synonyms:MTND6, NADH6, ND6

Expression Region:1-175

Sequence Info:full length protein

View full details