GeneBio Systems
Recombinant Drosophila melanogaster Protein shifted (shf)
Recombinant Drosophila melanogaster Protein shifted (shf)
SKU:Q9W3W5
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q9W3W5
Gene Names: shf
Alternative Name(s): (WIF-1-like protein)
Abbreviation: Recombinant Drosophila melanogaster shf protein
Organism: Drosophila melanogaster (Fruit fly)
Source: E.coli
Expression Region: 31-456aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: RQQHHNRNNNNNNRRADSSSSEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGGNGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHRNDDSKF
MW: 54.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Required for normal accumulation and movement of lipid-modified hedgehog (hh) morphogen. May act by stabilizing the interaction between heparan sulfate proteoglycans (HSPGs) and hh, HSPGs being required for diffusion of hh morphogen. Not involved in wingless (wg) morphogen movement, suggesting that it may provide HSPG specificity for Hh.
Reference: "The Drosophila ortholog of the human wnt inhibitor factor shifted controls the diffusion of lipid-modified hedgehog." Gorfinkiel N., Sierra J., Callejo A., Ibanez C., Guerrero I. Dev. Cell 8: 241-253(2005)
Function:
