Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 1(Tim17b1)

Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 1(Tim17b1)

SKU:CSB-CF896124DLU

Regular price £1,254.00 GBP
Regular price Sale price £1,254.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VNA0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSG LVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGG ALLALIEGVGIVVSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLAATYGEIDSSAL

Protein Names:Recommended name: Probable mitochondrial import inner membrane translocase subunit Tim17 1

Gene Names:Name:Tim17b1 ORF Names:CG1158

Expression Region:1-179

Sequence Info:full length protein

View full details