Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog T-cell surface glycoprotein CD4(CD4)

Recombinant Dog T-cell surface glycoprotein CD4(CD4)

SKU:CSB-CF004935DO

Regular price £1,502.00 GBP
Regular price Sale price £1,502.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:P33705

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VREVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWPKFLAITLGGILGLLLLIGLCVFCCVKCWRRRRQAERMSQIKRLLSEKKTCQCSHRIQKTCSLI

Protein Names:Recommended name: T-cell surface glycoprotein CD4 Alternative name(s): T-cell surface antigen T4/Leu-3 CD_antigen= CD4

Gene Names:Name:CD4

Expression Region:25-463

Sequence Info:full length protein

View full details