Recombinant Dog MMP13 protein(MMP13)

SKU: CSB-EP2042DO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: A0A0C6E3R7

Gene Names: MMP13

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: LPLPSDGDDDLSEEDFQLAERYLKSYYYPLNPAGILKKSAAGSVADRLREMQSFFGLEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKTNLTYRIVNYTPDLTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPRHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSRDLIFIFRGRKYWALNGYDILEGYPQKISELGFPKEVKKISAAVHFEDTGKTLFFSGNQVWSYDDTNQIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYNIWSKRIVRVMPANSLLWC

Expression Region: 28-478aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 67.5 kDa

Alternative Name(s):

Relevance:

Reference: "Expression of MMP13 in canine mammary tumor."Kumar B.V.S.Submitted (FEB-2015)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.