Gene Bio Systems
Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288353(DDB_G0288353)
Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0288353(DDB_G0288353)
SKU:CSB-CF700765DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q54J19
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVIPNLHNSIPICGKCDPKLTNSFIGIVLFLAVLIIGILILILFYYNKEINKNSSQYLPI HSPGSGNPSPSSSFLINNNNNNNNYHQNNNSNNNNIIYNPYYNSSTTSPYYLSPNSNHNP SLILYHQSRLLGNIHSINSINNNNNNNNNNPPTNISNKLNKNGETKNI
Protein Names:Recommended name: Putative uncharacterized transmembrane protein DDB_G0288353
Gene Names:ORF Names:DDB_G0288353
Expression Region:1-168
Sequence Info:full length protein
