Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein P(mcfP)

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein P(mcfP)

SKU:CSB-CF690534DKK

Regular price £1,356.00 GBP
Regular price Sale price £1,356.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54DU1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATTSVSSPKSKPSWVSFLSGGLAGVTAKSAVAPLERVKILYQIKSELYSLNSVYGSMLK IVENEGIKGLWRGNSATILRVFPYAAVQFLSYETIKNHLVADKSSSFQIFLAGSAAGGIA VCATYPLDLLRARLAIEIHKKPTKPHHLLKSTFTKDGVKGIYRGIQPTLIGILPYGGISF STFEFLKRIAPLNEIDENGQISGTYKLIAGGIAGGVAQTVAYPFDVVRRRVQTHGFGDAK AVVNLEHGTLRTIAHILKEEGILALYKGLSINYVKVIPTASIAFYTYEYLSNFFNKL

Protein Names:Recommended name: Mitochondrial substrate carrier family protein P Alternative name(s): Solute carrier family 25 member 16 homolog A

Gene Names:Name:mcfP Synonyms:slc25a16A ORF Names:DDB_G0292034

Expression Region:1-297

Sequence Info:full length protein

View full details