Gene Bio Systems
Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2(ost2)
Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2(ost2)
SKU:CSB-CF706703DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q54FB6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTTASTSSNNLTFTSIVKSFFESYSKTPQKLKIIDLFLIYTFITGVIVFTYCCLVGTYP FNSFLAAFISTVGCFVLTVCLRIQINPINNFGKTISIERAFTDYLLCNLILHLVVFNFLG
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 Short name= Oligosaccharyl transferase subunit 2 EC= 2.4.1.119
Gene Names:Name:ost2 ORF Names:DDB_G0291049
Expression Region:1-120
Sequence Info:full length protein
