Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2(ost2)

Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2(ost2)

SKU:CSB-CF706703DKK

Regular price £1,203.00 GBP
Regular price Sale price £1,203.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54FB6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTTASTSSNNLTFTSIVKSFFESYSKTPQKLKIIDLFLIYTFITGVIVFTYCCLVGTYP FNSFLAAFISTVGCFVLTVCLRIQINPINNFGKTISIERAFTDYLLCNLILHLVVFNFLG

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 Short name= Oligosaccharyl transferase subunit 2 EC= 2.4.1.119

Gene Names:Name:ost2 ORF Names:DDB_G0291049

Expression Region:1-120

Sequence Info:full length protein

View full details