Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Dolichol phosphate-mannose biosynthesis regulatory protein(dpm2-1)

Recombinant Dictyostelium discoideum Dolichol phosphate-mannose biosynthesis regulatory protein(dpm2-1)

SKU:CSB-CF700985DKK

Regular price £1,061.00 GBP
Regular price Sale price £1,061.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q556K9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGASDKFIGFVMVLFRIFVFGYYTTWVIITPFIVSDHWIQQYFLPREYGIIIPLVLLVVG ITAIGTFLGLVMIKSKKNK

Protein Names:Recommended name: Dolichol phosphate-mannose biosynthesis regulatory protein

Gene Names:Name:dpm2-1 ORF Names:DDB_G0272588 ANDName: dpm2-2ORF Names: DDB_G0273981

Expression Region:1-79

Sequence Info:full length protein

View full details