Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dickeya dadantii Protein AaeX(aaeX)

Recombinant Dickeya dadantii Protein AaeX(aaeX)

SKU:CSB-CF511899DKF

Regular price £1,152.00 GBP
Regular price Sale price £1,152.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dickeya dadantii (strain Ech703)

Uniprot NO.:C6C4L9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHSLPVMVLFGLSFPPIFFVLLVSLTLFFICIRLLHSSGIYEWVWHPALFNTSLFCCLFY LLFHLGV

Protein Names:Recommended name: Protein AaeX

Gene Names:Name:aaeX Ordered Locus Names:Dd703_3669

Expression Region:1-67

Sequence Info:full length protein

View full details