Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio magneticus NADH-quinone oxidoreductase subunit K(nuoK)

Recombinant Desulfovibrio magneticus NADH-quinone oxidoreductase subunit K(nuoK)

SKU:CSB-CF505407DJP

Regular price £1,188.00 GBP
Regular price Sale price £1,188.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)

Uniprot NO.:C4XMN4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIVPLSHVLAVAALLFAVGGVMAAARRSILLILIGVEFMLAAAGLAFAGAGLAWNNLDGQ AAVIIIMGLASAEAGLGLALLVHGRRGGGTDRADSYDRLGEES

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K

Gene Names:Name:nuoK Ordered Locus Names:DMR_13340

Expression Region:1-103

Sequence Info:full length protein

View full details