Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio desulfuricans UPF0059 membrane protein Ddes_1699 (Ddes_1699)

Recombinant Desulfovibrio desulfuricans UPF0059 membrane protein Ddes_1699 (Ddes_1699)

SKU:CSB-CF493733DJN

Regular price £1,281.00 GBP
Regular price Sale price £1,281.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)

Uniprot NO.:B8J1I9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIFAVFLLAIALSMDAFAVAVVSGCALQKPKVCHYVRLSAAFGFFQFAMPVIGWWLGVS VREYMEAWDHWIAFVLLGWIGGKMALSGLRALRNRESCACPSVDPTAGRNLVVLGVATSI DALAVGLSLAILGTPIWADAAIIGIVCAVITACGVYLGKTLANLCALNGWAELAGGLTLL AIACNILREHQVF

Protein Names:Recommended name: UPF0059 membrane protein Ddes_1699

Gene Names:Ordered Locus Names:Ddes_1699

Expression Region:1-193

Sequence Info:full length protein

View full details