Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2(DERF2)

SKU: CSB-EP312422DCO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q00855

Gene Names: DERF2

Organism: Dermatophagoides farinae (American house dust mite)

AA Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Expression Region: 18-146aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.1 kDa

Alternative Name(s): Allergen Der f II Allergen: Der f 2

Relevance:

Reference: "Cloning and expression of cDNA coding for the major house dust mite allergen Der f II in Escherichia coli."Yuuki T., Okumura Y., Ando T., Yamakawa H., Suko M., Haida M., Okudaira H.Agric. Biol. Chem. 55:1233-1238(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.