Skip to product information
1 of 1

Gene Bio Systems

Recombinant Deinococcus radiodurans UPF0126 membrane protein DR_2368(DR_2368)

Recombinant Deinococcus radiodurans UPF0126 membrane protein DR_2368(DR_2368)

SKU:CSB-CF886524DJA

Regular price £1,299.00 GBP
Regular price Sale price £1,299.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RRW7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDTLLTTYTLAEGLHWLDLIGVLAFAMSGALLGVRKRFDLFGVLVLGAVTAVGGGAIRD SLTGQTPPLFLRDETYLWTALLGALLAFAFGERLARFERTLSLFDSAGLALFATSGALGA IKIGLGPLGVVFAGMLSGVGGGIIRDLIANEVPEVMYRRDQLYATAAAAGAGAVWLLAPH FTPFQAQAGGALLVLFLRWVSRRQWVRLPVRRLPE

Protein Names:Recommended name: UPF0126 membrane protein DR_2368

Gene Names:Ordered Locus Names:DR_2368

Expression Region:1-215

Sequence Info:full length protein

View full details