Skip to product information
1 of 1

Gene Bio Systems

Recombinant Debaryomyces hansenii Glycosylphosphatidylinositol anchor biosynthesis protein 11(GPI11)

Recombinant Debaryomyces hansenii Glycosylphosphatidylinositol anchor biosynthesis protein 11(GPI11)

SKU:CSB-CF715318DIS

Regular price £1,315.00 GBP
Regular price Sale price £1,315.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Uniprot NO.:Q6BHK4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPKLKATRKSVSFQHLSDEDISKSQYILKTEFPRIETSTLTIPFHSALLIFGLYKFGLT NDIYGVMLKGIFSLIPLQLLYGYLITTRSEKEKKTKSHNNSENVPLLLAGGIVISLVLSV PLFVALILLGAPLASHLKETYLLSIHLSLLIFYPSLVLYKYDYKSLVKFLDADGVYNAIA KNQILLSAVLAVIGTWFGVIPIPLDWDRDWQQWPITLLTGAYIGSFVGGIACFLFQ

Protein Names:Recommended name: Glycosylphosphatidylinositol anchor biosynthesis protein 11

Gene Names:Name:GPI11 Ordered Locus Names:DEHA2G17886g

Expression Region:1-236

Sequence Info:full length protein

View full details