Gene Bio Systems
Recombinant Danio rerio UPF0708 protein C6orf162 homolog(si:busm1-189a20.6, si:ch211-241J12.5, zgc:112287)
Recombinant Danio rerio UPF0708 protein C6orf162 homolog(si:busm1-189a20.6, si:ch211-241J12.5, zgc:112287)
SKU:CSB-CF709472DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q502E5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSGQSSSSSGKAGPQEPPSSAAEPAYRSPGLRGVRTTSLFRAVNPELFIRPNKPVMALG LLALSVCVGYLGYLHAIRDSDQQLYEAVDSDGETYMRRRTSRWD
Protein Names:Recommended name: UPF0708 protein C6orf162 homolog
Gene Names:ORF Names:si:busm1-189a20.6, si:ch211-241J12.5, zgc:112287
Expression Region:1-104
Sequence Info:full length protein
