Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio UPF0444 transmembrane protein C12orf23 homolog(si:dkey-227k11.2, zgc:64098)

Recombinant Danio rerio UPF0444 transmembrane protein C12orf23 homolog(si:dkey-227k11.2, zgc:64098)

SKU:CSB-CF749232DIL

Regular price £1,203.00 GBP
Regular price Sale price £1,203.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q7T352

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSETNQQRDDLPAYLNDEPPADANKDHPQPQPGMFSRVAGGLFSVTKGAVGATVGGVAWV GGKSFDLTKTAVTSVASVPAMGVGLVKGGVSAVAGGVTAVGSAVVSKVPIGGGKKKDKSD

Protein Names:Recommended name: UPF0444 transmembrane protein C12orf23 homolog

Gene Names:ORF Names:si:dkey-227k11.2, zgc:64098

Expression Region:1-120

Sequence Info:full length protein

View full details