Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio UPF0197 transmembrane protein C11orf10 homolog(zgc:73269)

Recombinant Danio rerio UPF0197 transmembrane protein C11orf10 homolog(zgc:73269)

SKU:CSB-CF744100DIL

Regular price £1,178.00 GBP
Regular price Sale price £1,178.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6PBS6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFKAWFFVYEVTSTKYTRDVYKELLIALVA SLFMGFGVHFLLLWVGIFV

Protein Names:Recommended name: UPF0197 transmembrane protein C11orf10 homolog

Gene Names:ORF Names:zgc:73269

Expression Region:1-79

Sequence Info:full length protein

View full details