Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Tumor necrosis factor(TNF superfamily, member 2)(tnfb),partial

Recombinant Danio rerio Tumor necrosis factor(TNF superfamily, member 2)(tnfb),partial

SKU:CSB-EP2355DIL1

Regular price £584.00 GBP
Regular price Sale price £584.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q4W898

Gene Names: tnfb

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

AA Sequence: AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Expression Region: 101-242aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 19.8 kDa

Alternative Name(s): tnf TNF alpha

Relevance:

Reference: "Mmp23b promotes liver development and hepatocyte proliferation through the tumor necrosis factor pathway in zebrafish." Qi F., Song J., Yang H., Gao W., Liu N.A., Zhang B., Lin S. Hepatology 52:2158-2166(2010)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details