Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Transmembrane protein 18(tmem18)

Recombinant Danio rerio Transmembrane protein 18(tmem18)

SKU:CSB-CF023763DIL

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q641M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTASNTKNASAIPIDKFSNVRITSIWTFLQSVDWSEPWLMALLAFHVFCFAFTLLSCKYY RIQICHFLLMVAMVYSAEYLNELAAMNWRSFSKFQYFDSKGMFISLVYSVPLLLNTVIIV AVWVWRTFSTMTELKILQLKRKAARENHKKTQ

Protein Names:Recommended name: Transmembrane protein 18

Gene Names:Name:tmem18 ORF Names:zgc:101011

Expression Region:1-152

Sequence Info:full length protein

View full details