Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Solute carrier family 25 member 47-B(slc25a47b)

Recombinant Danio rerio Solute carrier family 25 member 47-B(slc25a47b)

SKU:CSB-CF390677DIL

Regular price £1,349.00 GBP
Regular price Sale price £1,349.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A4QNX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLADFLAGSVGGAFGVAVGYPLDTVKVRLQTQTGYSGFWQCVRKTCRNEGLQGFYRGMS MPISTVSISSSLVFGTYRNILQFLHQLQHRSAGEPHHKAHIFLAGFTGGVTQVLVMAPAD IVKVRLQCQTEPVQHISQESSSKYRGPVQCLLRIARDEGLLGLYKGSAALALRDGPSFAT YFLTYNTICEILTTENQRPGWPVVLLAGGVSGMCGWAVGTPMDVIKSRLQVDGVSGRRYR GFLHCITHSVRTEGSGVLFRGLTVNCIRAFPVNMSVFAMYEAVVRLLR

Protein Names:Recommended name: Solute carrier family 25 member 47-B Alternative name(s): Hepatocellular carcinoma down-regulated mitochondrial carrier homolog B

Gene Names:Name:slc25a47b Synonyms:hdmcpb ORF Names:zgc:162249

Expression Region:1-288

Sequence Info:full length protein

View full details