Recombinant Danio rerio Reactive oxygen species modulator 1(romo1)

SKU: CSB-CF020063DIL

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6NYD1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVSVGSYGQQAQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRIGMRGRELMGGVGKT MMQSGGTFGTFMAIGMGIRC

Protein Names:Recommended name: Reactive oxygen species modulator 1 Short name= ROS modulator 1 Alternative name(s): Protein MGR2 homolog

Gene Names:Name:romo1 ORF Names:zgc:73345

Expression Region:1-80

Sequence Info:full length protein