Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Protein Mpv17(mpv17)

Recombinant Danio rerio Protein Mpv17(mpv17)

SKU:CSB-CF735996DIL

Regular price £1,247.00 GBP
Regular price Sale price £1,247.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q5TZ51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGLWRSYQALMAKHPWKVQIITAGSLVGVGDVISQQLIERRGLANHNARRTAKMMSIGF FFVGPVVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEEN VAKLQRDYTDALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAVVWNSYLSWKANKM

Protein Names:Recommended name: Protein Mpv17

Gene Names:Name:mpv17 ORF Names:zgc:63573

Expression Region:1-177

Sequence Info:full length protein

View full details