Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Mitochondrial inner membrane protease subunit 2(immp2l)

Recombinant Danio rerio Mitochondrial inner membrane protease subunit 2(immp2l)

SKU:CSB-CF721486DIL

Regular price £1,251.00 GBP
Regular price Sale price £1,251.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6AZD4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQTGFGRRYFKAFVSGFFVAVPVTVTVLDRLAYVARVEGASMQPSLNPDGESSPDVVLL NRWSVRNYHVQRGDIVSVLSPKNPQQKIIKRVIGIEGDFIKTLGYKNRYVRVPDGHLWIE GDHHGHSFDSNAFGPVSLGLVHGRASHIIWPPSRWQRIEPSVPPDRRPLLNWDRAAEDKY DDD

Protein Names:Recommended name: Mitochondrial inner membrane protease subunit 2 EC= 3.4.21.- Alternative name(s): IMP2-like protein

Gene Names:Name:immp2l ORF Names:zgc:100888

Expression Region:1-183

Sequence Info:full length protein

View full details