Gene Bio Systems
Recombinant Danio rerio Cytochrome c oxidase protein 20 homolog(cox20)
Recombinant Danio rerio Cytochrome c oxidase protein 20 homolog(cox20)
SKU:CSB-CF732233DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q6DH88
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTEEDGKTQGMKVLGILDIHNTPCAREAILHGAAGSVAAGLLHFLATSRVKRSFDVGVAG FMITTLGSWFYCRYNNAKLRFQQRIIQEGLKNKVFYEGTDLDPTLKKTGDK
Protein Names:Recommended name: Cytochrome c oxidase protein 20 homolog
Gene Names:Name:cox20 Synonyms:fam36a ORF Names:zgc:92598
Expression Region:1-111
Sequence Info:full length protein
