Gene Bio Systems
Recombinant Danio rerio Apoptosis-related protein 3(apr3)
Recombinant Danio rerio Apoptosis-related protein 3(apr3)
SKU:CSB-CF003836DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:A3KNS9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QDTDAQLCQMCEGTIRHDSPVWSFCITKGYVKGHCCFKNNTSDVDTIIGLDLSNCSISHVEHLYNSSTALIIDLSNNPISNLSDYVFQGFSQLTQLLLPSKLECPGGRASWEKVEVKSITRICEGQKNACNQTVQMPLVCPENSLCSPYGPGFFECSCLNNFHGYKCMRQGEFPLVKVLGILTASTVVVSSVLWFTQRRKVKNT
Protein Names:Recommended name: Apoptosis-related protein 3 Short name= APR-3
Gene Names:Name:apr3 ORF Names:si:ch211-101l18.3
Expression Region:27-230
Sequence Info:full length protein
